SFPQ Rabbit pAb, Unconjugated

Catalog Number: ABB-A0958
Article Name: SFPQ Rabbit pAb, Unconjugated
Biozol Catalog Number: ABB-A0958
Supplier Catalog Number: A0958
Alternative Catalog Number: ABB-A0958-100UL,ABB-A0958-20UL,ABB-A0958-1000UL,ABB-A0958-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, IF, IHC-P, IP, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: PSF, POMP100, PPP1R140, SFPQ
Enables DNA binding activity, histone deacetylase binding activity, and protein homodimerization activity. Involved in several processes, including alternative mRNA splicing, via spliceosome, positive regulation of oxidative stress-induced intrinsic apoptotic signaling pathway, and regulation of transcription by RNA polymerase II. Acts upstream of or within double-strand break repair via homologous recombination. Located in chromatin, nuclear matrix, and paraspeckles.
Clonality: Polyclonal
Molecular Weight: 76kDa
NCBI: 6421
UniProt: P23246
Purity: Affinity purification
Sequence: MMIRQREMEEQMRRQREESYSRMGYMDPRERDMRMGGGGAMNMGDPYGSGGQKFPPLGGGGGIGYEANPGVPPATMSGSMMGSDMRTERFGQGGAGPVGGQGPRGMGPGTPAGYGRGREEYEGPNKKPRF
Target: SFPQ
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:100|IP,0.5µg-4µg antibody for 200µg-400µg extracts of whole cells|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,RNA Binding