Human Parkin Rabbit pAb, Unconjugated

Catalog Number: ABB-A0968
Article Name: Human Parkin Rabbit pAb, Unconjugated
Biozol Catalog Number: ABB-A0968
Supplier Catalog Number: A0968
Alternative Catalog Number: ABB-A0968-20UL,ABB-A0968-100UL,ABB-A0968-1000UL,ABB-A0968-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, IF, IHC-P, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: PDJ, AR-JP, LPRS2, PARK2, Parkin
The precise function of this gene is unknown, however, the encoded protein is a component of a multiprotein E3 ubiquitin ligase complex that mediates the targeting of substrate proteins for proteasomal degradation. Mutations in this gene are known to cause Parkinson disease and autosomal recessive juvenile Parkinson disease. Alternative splicing of this gene produces multiple transcript variants encoding distinct isoforms. Additional splice variants of this gene have been described but currently lack transcript support.
Clonality: Polyclonal
Molecular Weight: 52kDa
NCBI: 5071
UniProt: O60260
Purity: Affinity purification
Sequence: NATGGDDPRNAAGGCEREPQSLTRVDLSSSVLPGDSVGLAVILHTDSRKDSPPAGSPAGRSIYNSFYVYCKGPCQRVQPGKLRVQCSTCRQATLTLTQGPSCWDDVLIPNRMSGECQSPHCPGTSAEFFFKCGAHPTSDKETSVALHLIATNSRNITCITCTDVRSPVLVFQCNSRHVICLDCFHLYCVTRLNDRQFVHD
Target: PRKN
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:1000|IF-P,1:50 - 1:200|IHC-P,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Signal Transduction,Kinase,Tyrosine kinases,ErbB-HER Signaling Pathway,Cell Biology Developmental Biology,Autophagy,Ubiquitin,Ubiquitin-Proteasome Signaling Pathway,Endocrine Metabolism,Mitochondrial metabolism,Insulin Receptor Signaling Pathway,Immunology Inflammation,B Cell Receptor Signaling Pathway,Jak-Stat-IL-6 Receptor Signaling Pathway,Neuroscience,Neurodegenerative Diseases,Dopamine Signaling in Parkinsons Disease,Neurodegenerative Diseases Markers