NEK8 Rabbit pAb, Unconjugated

Catalog Number: ABB-A0984
Article Name: NEK8 Rabbit pAb, Unconjugated
Biozol Catalog Number: ABB-A0984
Supplier Catalog Number: A0984
Alternative Catalog Number: ABB-A0984-100UL,ABB-A0984-20UL,ABB-A0984-500UL,ABB-A0984-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, IF, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: JCK, NPHP9, RHPD2, NEK12A, NEK8
This gene encodes a member of the serine/threionine protein kinase family related to NIMA (never in mitosis, gene A) of Aspergillus nidulans. The encoded protein may play a role in cell cycle progression from G2 to M phase. Mutations in the related mouse gene are associated with a disease phenotype that closely parallels the juvenile autosomal recessive form of polycystic kidney disease in humans.
Clonality: Polyclonal
Molecular Weight: 75kDa
NCBI: 284086
UniProt: Q86SG6
Purity: Affinity purification
Sequence: GSVRMRRAEKSVAPSNTGSRTTSVRCRGIPRGPVRPAIPPPLSSVYAWGGGLGTPLRLPMLNTEVVQVAAGRTQKAGVTRSGRLILWEAPPLGAGGGSLLPGAVEQPQPQFISRFLEGQSG
Target: NEK8
Antibody Type: Primary Antibody
Application Dilute: WB,1:100 - 1:500|IF/ICC,1:100 - 1:500|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Kinase,Cell Cycle,Centrosome