SYT1 Rabbit pAb, Unconjugated

Product Overview

• Article Name: SYT1 Rabbit pAb, Unconjugated
• Biozol Catalog Number: ABB-A0992
• Supplier Catalog Number: A0992
• Alternative Catalog Number: ABB-A0992-100UL,ABB-A0992-20UL,ABB-A0992-1000UL,ABB-A0992-500UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, IF, IHC-P, WB
• Species Reactivity: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: P65, SYT, BAGOS, SVP65, SYT1

Product Description

This gene encodes a member of the synaptotagmin protein family. The synaptotagmins are integral membrane proteins of synaptic vesicles that serve as calcium sensors in the process of vesicular trafficking and exocytosis. The encoded protein participates in triggering neurotransmitter release at the synapse in response to calcium binding. Mutations in this gene are associated with Baker-Gordon syndrome.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 48kDa
• NCBI: 6857
• UniProt: P21579
• Purity: Affinity purification
• Sequence: LFKKKNKKKGKEKGGKNAINMKDVKDLGKTMKDQALKDDDAETGLTDGEEKEEPKEEEKLGKLQYSLDYDFQNN
• Target: SYT1
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:1000|IF-P,1:50 - 1:200|IHC-P, 5000-20000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Signal Transduction,Neuroscience, Cell Type Marker,Neuron marker,Synapse marker

Images