KLF6 Rabbit pAb, Unconjugated

Product Overview

• Article Name: KLF6 Rabbit pAb, Unconjugated
• Biozol Catalog Number: ABB-A10011
• Supplier Catalog Number: A10011
• Alternative Catalog Number: ABB-A10011-100UL,ABB-A10011-20UL,ABB-A10011-1000UL,ABB-A10011-500UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, IF, IHC-P, WB
• Species Reactivity: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: GBF, ZF9, BCD1, CBA1, CPBP, PAC1, ST12, COPEB, KLF6

Product Description

This gene encodes a member of the Kruppel-like family of transcription factors. The zinc finger protein is a transcriptional activator, and functions as a tumor suppressor. Multiple transcript variants encoding different isoforms have been found for this gene, some of which are implicated in carcinogenesis.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 32kDa
• NCBI: 1316
• UniProt: Q99612
• Purity: Affinity purification
• Sequence: ERYLQSEPCYVSASEIKFDSQEDLWTKIILAREKKEESELKISSSPPEDTLISPSFCYNLETNSLNSDVSSESSDSSEELSPTAKFTSDPIGEVLVSSGKLSSSVTSTPPSSPELSREPSQLWGCVPGELPSPGKVRSGTSGKPGDKGNGDASPDGRRRVH
• Target: KLF6
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:100|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human,Mouse. ResearchArea: Epigenetics Nuclear Signaling,Transcription Factors,Stem Cells,Hematopoietic Progenitors

Images