KLHL9 Rabbit pAb, Unconjugated

Catalog Number: ABB-A10149
Article Name: KLHL9 Rabbit pAb, Unconjugated
Biozol Catalog Number: ABB-A10149
Supplier Catalog Number: A10149
Alternative Catalog Number: ABB-A10149-100UL,ABB-A10149-20UL,ABB-A10149-500UL,ABB-A10149-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, IHC-P, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: KLHL9
This gene encodes a protein that belongs to the kelch repeat-containing family, and contains an N-terminal BTB/POZ domain, a BACK domain and six C-terminal kelch repeats. The encoded protein is a component of a complex with cullin 3-based E3 ligase, which plays a role in mitosis. This protein complex is a cell cycle regulator, and functions in the organization and integrity of the spindle midzone in anaphase and the completion of cytokinesis. The complex is required for the removal of the chromosomal passenger protein aurora B from mitotic chromosomes.
Clonality: Polyclonal
Molecular Weight: 69kDa
NCBI: 55958
UniProt: Q9P2J3
Purity: Affinity purification
Sequence: MKVSLGNGEMGVSAHLQPCKAGTTRFFTSNTHSSVVLQGFDQLRIEGLLCDVTLVPGDGDEIFPVHRAMMASASDYFKAMFTGGMKEQDLMCIKLHGVNK
Target: KLHL9
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cell Biology Developmental Biology,Cell Cycle,Cell differentiation,Ubiquitin,Ubiquitin-Proteasome Signaling Pathway