Alpha-1 Antitrypsin (SERPINA1) Rabbit pAb, Unconjugated

Catalog Number: ABB-A1015
Article Name: Alpha-1 Antitrypsin (SERPINA1) Rabbit pAb, Unconjugated
Biozol Catalog Number: ABB-A1015
Supplier Catalog Number: A1015
Alternative Catalog Number: ABB-A1015-100UL,ABB-A1015-20UL,ABB-A1015-500UL,ABB-A1015-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, IF, IHC-P, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: PI, A1A, AAT, PI1, A1AT, nNIF, PRO2275, alpha1AT, Alpha-1 Antitrypsin (SERPINA1)
The protein encoded by this gene is a serine protease inhibitor belonging to the serpin superfamily whose targets include elastase, plasmin, thrombin, trypsin, chymotrypsin, and plasminogen activator. This protein is produced in the liver, the bone marrow, by lymphocytic and monocytic cells in lymphoid tissue, and by the Paneth cells of the gut. Defects in this gene are associated with chronic obstructive pulmonary disease, emphysema, and chronic liver disease. Several transcript variants encoding the same protein have been found for this gene.
Clonality: Polyclonal
Molecular Weight: 47kDa
NCBI: 5265
UniProt: P01009
Purity: Affinity purification
Sequence: EDVKKLYHSEAFTVNFGDTEEAKKQINDYVEKGTQGKIVDLVKELDRDTVFALVNYIFFKGKWERPFEVKDTEEEDFHVDQVTTVKVPMMKRLGMFNIQH
Target: SERPINA1
Antibody Type: Primary Antibody
Application Dilute: WB,1:100 - 1:500|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse. ResearchArea: Cancer,Endocrine Metabolism,Cardiovascular,Blood,Serum Proteins,Hypoxia