CNPase Rabbit pAb, Unconjugated

Product Overview

• Article Name: CNPase Rabbit pAb, Unconjugated
• Biozol Catalog Number: ABB-A1018
• Supplier Catalog Number: A1018
• Alternative Catalog Number: ABB-A1018-100UL,ABB-A1018-20UL,ABB-A1018-1000UL,ABB-A1018-500UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, IF, WB
• Species Reactivity: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: CNP1, HLD20, CNPase

Product Description

Predicted to enable 2,3-cyclic-nucleotide 3-phosphodiesterase activity. Involved in substantia nigra development. Located in several cellular components, including extracellular space, microtubule, and plasma membrane. Implicated in hypomyelinating leukodystrophy 20, multiple sclerosis, and schizophrenia. Biomarker of alcoholic liver cirrhosis, multiple sclerosis, and restless legs syndrome.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 48kDa
• NCBI: 1267
• UniProt: P09543
• Purity: Affinity purification
• Sequence: PKTAWRLDCAQLKEKNQWQLSADDLKKLKPGLEKDFLPLYFGWFLTKKSSETLRKAGQVFLEELGNHKAFKKELRQFVPGDEPREKMDLVTYFGKRPPGVLHCTTKFCDYGKAPGAEEYAQQDVLKKSYSKAFTLTISALFVTPKTTGARVELSEQQLQLWPSDVDKLSPTDNLPRGSRAHITLGCAADVEAVQTGLDLLEILRQEKGGSRGEEVGELSRGKLYSLGNGRWMLTLAKNMEVRAIFTGYYGKGKPV
• Target: CNP
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:2000|IF-P,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Neuroscience, Cell Type Marker,Neurodegenerative Diseases

Images