KIF4A Rabbit pAb, Unconjugated

Catalog Number: ABB-A10193
Article Name: KIF4A Rabbit pAb, Unconjugated
Biozol Catalog Number: ABB-A10193
Supplier Catalog Number: A10193
Alternative Catalog Number: ABB-A10193-100UL,ABB-A10193-20UL,ABB-A10193-1000UL,ABB-A10193-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, IF, IHC-P, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: KIF4, KIF4G1, MRX100, XLID100, KIF4A
This gene encodes a member of the kinesin 4 subfamily of kinesin related proteins. The encoded protein is an ATP dependent microtubule-based motor protein that is involved in the intracellular transport of membranous organelles. This protein also associates with condensed chromosome arms and may be involved in maintaining chromosome integrity during mitosis. This protein may also be involved in the organization of the central spindle prior to cytokinesis. A pseudogene of this gene is found on chromosome X.
Clonality: Polyclonal
Molecular Weight: 140kDa
NCBI: 24137
UniProt: O95239
Purity: Affinity purification
Sequence: LIGELVSSKIQVSKLESSLKQSKTSCADMQKMLFEERNHFAEIETELQAELVRMEQQHQEKVLYLLSQLQQSQMAEKQLEESVSEKEQQLLSTLKCQDEELEKMREVCEQNQQLLRENEIIKQKLTLLQVASRQKHLPKDTLLSPDSSFEYVPPKPKPSRVKEKFLEQSMDIEDLKYCSEHSVNEHEDGDGDDDEGDDEEWKPTKLVKVSR
Target: KIF4A
Antibody Type: Primary Antibody
Application Dilute: WB,1:1000 - 1:3000|IHC-P,1:50 - 1:200|IF/ICC,1:100 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Signal Transduction,Cell Biology Developmental Biology,Apoptosis,Cell Cycle,Cytoskeleton,Motor Proteins