CLDN5 Rabbit pAb, Unconjugated

Catalog Number: ABB-A10207
Article Name: CLDN5 Rabbit pAb, Unconjugated
Biozol Catalog Number: ABB-A10207
Supplier Catalog Number: A10207
Alternative Catalog Number: ABB-A10207-20UL,ABB-A10207-100UL,ABB-A10207-500UL,ABB-A10207-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, IF, IHC-P, WB
Species Reactivity: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: AWAL, BEC1, TMVCF, TMDVCF, CPETRL1, CLDN5
This gene encodes a member of the claudin family. Claudins are integral membrane proteins and components of tight junction strands. Tight junction strands serve as a physical barrier to prevent solutes and water from passing freely through the paracellular space between epithelial or endothelial cell sheets. Mutations in this gene have been found in patients with velocardiofacial syndrome. Alternative splicing results in multiple transcript variants encoding distinct isoforms.
Clonality: Polyclonal
Molecular Weight: 23kDa
NCBI: 7122
UniProt: O00501
Purity: Affinity purification
Sequence: LTGGVLYLFCGLLALVPLCWFANIVVREFYDPSVPVSQKYELGAALYIGWAATALLMVGGCLLCCGAWVCTGRPDLSFPVKYSAPRRPTATGDYDKKNYV
Target: CLDN5
Antibody Type: Primary Antibody
Application Dilute: WB,1:1000 - 1:5000|IHC-P,1:1000 - 1:4000|IF/ICC,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Signal Transduction,Cell Biology Developmental Biology,Cell Adhesion,Tight Junctions,Cytoskeleton