HINT1 Rabbit pAb, Unconjugated

Catalog Number: ABB-A10221
Article Name: HINT1 Rabbit pAb, Unconjugated
Biozol Catalog Number: ABB-A10221
Supplier Catalog Number: A10221
Alternative Catalog Number: ABB-A10221-100UL,ABB-A10221-20UL,ABB-A10221-500UL,ABB-A10221-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, IF, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: HINT, NMAN, PKCI-1, PRKCNH1, HINT1
This gene encodes a protein that hydrolyzes purine nucleotide phosphoramidates substrates, including AMP-morpholidate, AMP-N-alanine methyl ester, AMP-alpha-acetyl lysine methyl ester, and AMP-NH2. The encoded protein interacts with these substrates via a histidine triad motif. This gene is considered a tumor suppressor gene. In addition, mutations in this gene can cause autosomal recessive neuromyotonia and axonal neuropathy. There are several related pseudogenes on chromosome 7. Several transcript variants have been observed.
Clonality: Polyclonal
Molecular Weight: 14kDa
NCBI: 3094
UniProt: P49773
Purity: Affinity purification
Sequence: MADEIAKAQVARPGGDTIFGKIIRKEIPAKIIFEDDRCLAFHDISPQAPTHFLVIPKKHISQISVAEDDDESLLGHLMIVGKKCAADLGLNKGYRMVVNEGSDGGQSVYHVHLHVLGGRQMHWPPG
Target: HINT1
Antibody Type: Primary Antibody
Application Dilute: WB,1:1000 - 1:2000|IF/ICC,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Cancer,Tumor suppressors