DMT1/SLC11A2 Rabbit pAb, Unconjugated

Catalog Number: ABB-A10231
Article Name: DMT1/SLC11A2 Rabbit pAb, Unconjugated
Biozol Catalog Number: ABB-A10231
Supplier Catalog Number: A10231
Alternative Catalog Number: ABB-A10231-20UL,ABB-A10231-100UL,ABB-A10231-500UL,ABB-A10231-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, IHC-P, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: DCT1, DMT1, AHMIO1, NRAMP2, DMT1/SLC11A2
This gene encodes a member of the solute carrier family 11 protein family. The product of this gene transports divalent metals and is involved in iron absorption. Mutations in this gene are associated with hypochromic microcytic anemia with iron overload. A related solute carrier family 11 protein gene is located on chromosome 2. Multiple transcript variants encoding different isoforms have been found for this gene.
Clonality: Polyclonal
Molecular Weight: 62kDa
NCBI: 4891
UniProt: P49281
Purity: Affinity purification
Sequence: MVLGPEQKMSDDSVSGDHGESASLGNINPAYSNPSLSQSPGDSEEYFATYFNEKISIPEEEYS
Target: SLC11A2
Antibody Type: Primary Antibody
Application Dilute: WB,1:1000 - 1:2000|IHC-P,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cardiovascular,Blood,Serum Proteins