Septin 4 Rabbit pAb, Unconjugated

Catalog Number: ABB-A10238
Article Name: Septin 4 Rabbit pAb, Unconjugated
Biozol Catalog Number: ABB-A10238
Supplier Catalog Number: A10238
Alternative Catalog Number: ABB-A10238-100UL,ABB-A10238-20UL,ABB-A10238-1000UL,ABB-A10238-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, IF, IHC-P, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: H5, ARTS, MART, SEP4, CE5B3, SEPT4, PNUTL2, hucep-7, BRADEION, C17orf47, hCDCREL-2, Septin 4
This gene is a member of the septin family of nucleotide binding proteins, originally described in yeast as cell division cycle regulatory proteins. Septins are highly conserved in yeast, Drosophila, and mouse, and appear to regulate cytoskeletal organization. Disruption of septin function disturbs cytokinesis and results in large multinucleate or polyploid cells. This gene is highly expressed in brain and heart. Alternatively spliced transcript variants encoding different isoforms have been described for this gene. One of the isoforms (known as ARTS) is distinct, it is localized to the mitochondria, and has a role in apoptosis and cancer.
Clonality: Polyclonal
Molecular Weight: 55kDa
NCBI: 5414
UniProt: O43236
Purity: Affinity purification
Sequence: MIKRFLEDTTDDGELSKFVKDFSGNASCHPPEAKTWASRPQVPEPRPQAPDLYDDDLEFRPPSRPQSSDNQQYFCAPAPLSPSARPRSPWGKLDPYDSSE
Target: SEPTIN4
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cell Biology Developmental Biology,Apoptosis,Mitochondrial Control of Apoptosis,Cell Cycle,Endocrine Metabolism,Mitochondrial metabolism,Mitochondrial markers,Immunology Inflammation,Cytokines