Cytokeratin 8 (KRT8) Rabbit pAb, Unconjugated

Catalog Number: ABB-A1024
Article Name: Cytokeratin 8 (KRT8) Rabbit pAb, Unconjugated
Biozol Catalog Number: ABB-A1024
Supplier Catalog Number: A1024
Alternative Catalog Number: ABB-A1024-100UL,ABB-A1024-20UL,ABB-A1024-1000UL,ABB-A1024-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, IF, IHC-P, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: K8, KO, CK8, CK-8, CYK8, K2C8, CARD2, Cytokeratin 8 (KRT8)
This gene is a member of the type II keratin family clustered on the long arm of chromosome 12. Type I and type II keratins heteropolymerize to form intermediate-sized filaments in the cytoplasm of epithelial cells. The product of this gene typically dimerizes with keratin 18 to form an intermediate filament in simple single-layered epithelial cells. This protein plays a role in maintaining cellular structural integrity and also functions in signal transduction and cellular differentiation. Mutations in this gene cause cryptogenic cirrhosis. Alternatively spliced transcript variants have been found for this gene.
Clonality: Polyclonal
Molecular Weight: 54 kDa/56 kDa
NCBI: 3856
UniProt: P05787
Purity: Affinity purification
Sequence: MSIRVTQKSYKVSTSGPRAFSSRSYTSGPGSRISSSSFSRVGSSNFRGGLGGGYGGASGMGGITAVTVNQSLLSPLVLEVDPNIQAVRTQEKEQIKTLNNKFASFIDKVRFLEQQNKMLETKWSLLQQQKTARSNMDNMFESYINNLRRQLETLGQEKLKLEAELGNMQGLVEDFKNKYEDEINKRTEMENEFVLIKKDVDEAYMNKVELESRLEGLTDEINFLRQLYEEEIRELQSQISDTSVVLSMDNSRSLD
Target: KRT8
Antibody Type: Primary Antibody
Application Dilute: WB,1:2000 - 1:4000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cancer,Invasion and Metastasis,Signal Transduction,Cell Biology Developmental Biology,Cell Adhesion,Cytoskeleton,Intermediate Filaments