Recombinant Monkeypox virus M1R Protein, Human

Catalog Number: ABB-RP03292
Article Name: Recombinant Monkeypox virus M1R Protein, Human
Biozol Catalog Number: ABB-RP03292
Supplier Catalog Number: RP03292
Alternative Catalog Number: ABB-RP03292-100UG
Manufacturer: ABclonal
Host: Human
Category: Proteine/Peptide
Species Reactivity: Virus
Immunogen: Gly2-Gly183
Alternative Names: M1R, Monkeypox virus M1R, MPXV M1R
Monkeypox virus (MPXV) is double-stranded DNA virus belonging to the genus orthopoxvirus that causes a smallpox-like disease in humans. M1R is homologous to the vaccinia virus L1 protein, a transmembrane protein found on the surface of mature IMV particles. And M1R is the component of the entry fusion complex (EFC), which consists of 11 proteins. During cell infection, this complex mediates entry of the virion core into the host cytoplasm by a two-step mechanism consisting of lipid mixing of the viral and cellular membranes and subsequent pore formation.
Concentration: < 1 EU/µg of the protein by LAL method.
Molecular Weight: 20.41 kDa
NCBI: 928968
UniProt: Q8V502
Purity: 95 % as determined by Tris-Bis PAGE, 95 % as determined by HPLC.
Form: Lyophilized from a 0.22 µm filtered solution of PBS, pH 7.4. Contact us for customized product form or formulation.
Sequence: MGAAASIQTTVNTLSERISSKLEQEANASAQTKCDIEIGNFYIRQNHGCNITVKNMCSADADAQLDAVLSAATETYSGLTPEQKAYVPAMFTAALNIQTSVNTVVRDFENYVKQTCNSSAVVDNKLKIQNVIIDECYGAPGSPTNLEFINTGSSKGNCAIKALMQLTTKATTQIAPRQVAGTGVQFYMIVIGVIILAALFMYYAKRMLFTSTNDKIKLILANKENVHWTTYMDTFFRTSPMIIATTDIQN
Target: Monkeypox virus M1R
Application Dilute: Lyophilized from a 0.22 µm filtered solution of PBS, pH 7.4. Contact us for customized product form or formulation.
Application Notes: Cross-Reactivity: Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage,it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA,5% HSA,10% FBS or 5% Trehalose),and aliquot the reconstituted protein solution to minimize free-thaw cycles. ResearchArea: Other Recombinant Protein