Recombinant Human IL-1 alpha Protein, E. coli

Catalog Number: ABB-RP03505
Article Name: Recombinant Human IL-1 alpha Protein, E. coli
Biozol Catalog Number: ABB-RP03505
Supplier Catalog Number: RP03505
Alternative Catalog Number: ABB-RP03505-20UG,ABB-RP03505-10UG,ABB-RP03505-50UG,ABB-RP03505-100UG
Manufacturer: ABclonal
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Human
Immunogen: Ser113-Ala271
Alternative Names: IL1A, IL1F1, Interleukin-1 alpha, IL-1 alpha, Hematopoietin-1
The protein encoded by this gene is a member of the interleukin 1 cytokine family. This cytokine is a pleiotropic cytokine involved in various immune responses, inflammatory processes, and hematopoiesis. This cytokine is produced by monocytes and macrophages as a proprotein, which is proteolytically processed and released in response to cell injury, and thus induces apoptosis. This gene and eight other interleukin 1 family genes form a cytokine gene cluster on chromosome 2. It has been suggested that the polymorphism of these genes is associated with rheumatoid arthritis and Alzheimers disease.
Concentration: Please contact us for more information.
Molecular Weight: 18.05 kDa
NCBI: 3552
UniProt: P01583
Purity: 95 % as determined by SDS-PAGE.
Form: Lyophilized from 0.22µm filtered solution in PBS (pH 7.4).
Sequence: SAPFSFLSNVKYNFMRIIKYEFILNDALNQSIIRANDQYLTAAALHNLDEAVKFDMGAYKSSKDDAKITVILRISKTQLYVTAQDEDQPVLLKEMPEIPKTITGSETNLLFFWETHGTKNYFTSVAHPNLFIATKQDYWVCLAGGPPSITDFQILENQA
Target: IL1A, IL1F1
Application Dilute: Lyophilized from 0.22µm filtered solution in PBS (pH 7.4).
Application Notes: Cross-Reactivity: Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage,it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA,5% HSA,10% FBS or 5% Trehalose),and aliquot the reconstituted protein solution to minimize free-thaw cycles. ResearchArea: Interleukin,Cell Culture related,Biosimilar Drug Targets