Recombinant Human SLC3A2/CD98 Protein

Product Overview

• Article Name: Recombinant Human SLC3A2/CD98 Protein
• Biozol Catalog Number: ABB-RP03523
• Supplier Catalog Number: RP03523
• Alternative Catalog Number: ABB-RP03523-100UG
• Manufacturer: ABclonal
• Host: Human
• Category: Proteine/Peptide
• Species Reactivity: Human
• Immunogen: Arg206-Ala630
• Alternative Names: SLC3A2, MDU1,Amino acid transporter heavy chain SLC3A2,CD98

Product Description

This protein is a member of the solute carrier family and encodes a cell surface, transmembrane protein. The protein exists as the heavy chain of a heterodimer, covalently bound through di-sulfide bonds to one of several possible light chains. The encoded transporter plays a role in regulation of intracellular calcium levels and transports L-type amino acids. Alternatively spliced transcript variants, encoding different isoforms, have been characterized.

Product Properties

• Concentration: < 1 EU/µg of the protein by LAL method.
• Molecular Weight: 47.9 kDa
• NCBI: 6520
• UniProt: P08195
• Purity: 95 % as determined by Tris-Bis PAGE, 95 % as determined by HPLC.
• Form: Lyophilized from 0.22µm filtered solution in PBS (pH 7.4). Normally 8% trehalose is added as protectant before lyophilization.
• Sequence: RAPRCRELPAQKWWHTGALYRIGDLQAFQGHGAGNLAGLKGRLDYLSSLKVKGLVLGPIHKNQKDDVAQTDLLQIDPNFGSKEDFDSLLQSAKKKSIRVILDLTPNYRGENSWFSTQVDTVATKVKDALEFWLQAGVDGFQVRDIENLKDASSFLAEWQNITKGFSEDRLLIAGTNSSDLQQILSLLESNKDLLLTSSYLSDSGSTGEHTKSLVTQYLNATGNRWCSWSLSQARLLTSFLPAQLLRLYQLMLFTL
• Target: SLC3A2, MDU1

Application Notes

• Application Dilute: Lyophilized from 0.22µm filtered solution in PBS (pH 7.4). Normally 8% trehalose is added as protectant before lyophilization.
• Application Notes: Cross-Reactivity: Centrifuge the tube before opening. Reconstituting to a concentration more than 100 µg/ml is recommended. Dissolve the lyophilized protein in distilled water. ResearchArea: Bio-Markers & CD Antigens