Recombinant Serratia marcescens Nuclease, Yeast

Catalog Number: ABB-RPT0008LQ
Article Name: Recombinant Serratia marcescens Nuclease, Yeast
Biozol Catalog Number: ABB-RPT0008LQ
Supplier Catalog Number: RPT0008LQ
Alternative Catalog Number: ABB-RPT0008LQ-20KU,ABB-RPT0008LQ-500KU,ABB-RPT0008LQ-100KU,ABB-RPT0008LQ-50KU
Manufacturer: ABclonal
Host: Yeast
Category: Proteine/Peptide
Species Reactivity: Bacteria
Immunogen: Asp22-Asn266
Alternative Names: Endonuclease, Nuclease, nucA, nuc
Catalyzes the hydrolysis of both DNA and RNA, double- or single-stranded, at the 3position of the phosphodiester bond to produce 5-phosphorylated mono-, di-, tri- and tetranucleotides. DNA is a slightly better substrate than RNA.
Concentration: < 0.1 EU/µg of the protein by LAL method.
Molecular Weight: 26.71 kDa
NCBI: 87005285
UniProt: P13717
Purity: 95 % as determined by SDS-PAGE.
Form: Solution in 50% glycerol containing 20 mM Tris HCl, pH 8.0, 2 mM MgCl2, and 20 mM NaCl.
Sequence: DTLESIDNCAVGCPTGGSSNVSIVRHAYTLNNNSTTKFANWVAYHITKDTPASGKTRNWKTDPALNPADTLAPADYTGANAALKVDRGHQAPLASLAGVSDWESLNYLSNITPQKSDLNQGAWARLEDQERKLIDRADISSVYTVTGPLYERDMGKLPGTQKAHTIPSAYWKVIFINNSPAVNHYAAFLFDQNTPKGADFCQFRVTVDEIEKRTGLIIWAGLPDDVQASLKSKPGVLPELMGCKN
Target: Nuclease
Application Dilute: Solution in 50% glycerol containing 20 mM Tris HCl, pH 8.0, 2 mM MgCl2, and 20 mM NaCl.
Application Notes: ResearchArea: Tool proteins