Anti-RLBP1
Catalog Number:
ATA-HPA044083
- Images (6)
| Article Name: | Anti-RLBP1 |
| Biozol Catalog Number: | ATA-HPA044083 |
| Supplier Catalog Number: | HPA044083 |
| Alternative Catalog Number: | ATA-HPA044083-100,ATA-HPA044083-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Sonstiges |
| Application: | ICC, IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | CRALBP |
| retinaldehyde binding protein 1 |
| Anti-RLBP1 |
| Clonality: | Polyclonal |
| Concentration: | 0.2 mg/ml |
| Isotype: | IgG |
| NCBI: | 6017 |
| UniProt: | P12271 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | PARFKAIHFIHQPWYFTTTYNVVKPFLKSKLLERVFVHGDDLSGFYQEIDENILPSD |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | RLBP1 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | ICC-IF: 0.25-2 µg/ml, IHC: 1:5000 - 1:10000 |
|
|
Immunofluorescent staining of human cell line SK-MEL-30 shows localization to nucleoplasm, cytosol & centrosome. |
|
|
Immunohistochemical staining of human retina shows strong positivity in pigment epithelium, Mueller glia and inner nuclear layer. |
|
|
HPA044083-100ul |
|
|
|
|
|
HPA044083-100ul |
|
|
HPA044083-100ul |
Product Guarantee and Expert Support
