Anti-SACM1L Antibody , Unconjugated, Rabbit, Polyclonal

Product Overview

• Article Name: Anti-SACM1L Antibody , Unconjugated, Rabbit, Polyclonal
• Biozol Catalog Number: ATA-HPA069869
• Supplier Catalog Number: HPA069869
• Alternative Catalog Number: ATA-HPA069869-100,ATA-HPA069869-25
• Manufacturer: Atlas Antibodies
• Host: Rabbit
• Category: Antikörper
• Application: ICC
• Species Reactivity: Human
• Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
• Conjugation: Unconjugated
• Alternative Names: KIAA0851, SAC1

Product Properties

• Clonality: Polyclonal
• NCBI: 22908
• UniProt: Q9NTJ5
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
• Purity: Affinity purified using the PrEST antigen as affinity ligand
• Sequence: NVIQSLLARRSLQAQLQRLGVLHVGQKLEEQDEFEKIYKNAWADNANACAKQYAGTGALKT
• Target: SACM1L