Recombinant Macaca fascicularis CD93 molecule (CD93), partial , Active Protein, Unconjugated, Mammal

Catalog Number: BIM-RPC29753
Article Name: Recombinant Macaca fascicularis CD93 molecule (CD93), partial , Active Protein, Unconjugated, Mammal
Biozol Catalog Number: BIM-RPC29753
Supplier Catalog Number: RPC29753
Alternative Catalog Number: BIM-RPC29753-20UG,BIM-RPC29753-100UG,BIM-RPC29753-1MG
Manufacturer: Biomatik Corporation
Host: Mammal
Category: Proteine/Peptide
Species Reactivity: Bacteria
Conjugation: Unconjugated
Accession Number: A0A2K5VH53; CD93. Activity: Biologically Active. Endotoxin Level: <1.0 EU/ug, by LAL method. Expiration: 12 months. Expression Region: 24-581aa. Protein Length: Partial. Protein Type: Active Recombinant Protein. Quality Guarantee: This product carries the Biomatik 100% Quality Guarantee. Please refer to the Terms and Conditions for details. Quality Systems: This product is manufactured at ISO 9001 certified facilities. Reconstitution: Refer to the datasheet/CoA included in the product pouch. Research Area: Others. Shipping Condition: Ice packs. Short Description: Recombinant Macaca fascicularis CD93 molecule (CD93), partial , Active Protein is a purified Active Recombinant Protein
Molecular Weight: 60.2kDa
Tag: C-Terminal 10xHis-Tagged
Purity: >95% by SDS-PAGE
Sequence: ADTEAVVCAGTACYTAHWGKLSAAEAQNLCLQNGGNLATVKSEEEAQHVQQVLAQLLRREAALTARMGKFWIGLQREKGKCLDPSLPLKGFSWVGGGEDTPYSNWHKELRNSCISKRCVSLLLDLSQPLLPGRLPKWSEGPCGSPGSPGSNIEGFVCKFSFKGMCRPLALGGPGQVTYTTPFQTTSSSLEAVPFASAANVACGEGDKDDSQSHYFLCKEKAPDVFDWGSSGPLCVSPKYGCNFNNGGCHQDCFE
Target: CD93 molecule (CD93)