Recombinant Macaca fascicularis Interferon gamma (IFNG), Unconjugated, Yeast

Catalog Number: BIM-RPC29754
Article Name: Recombinant Macaca fascicularis Interferon gamma (IFNG), Unconjugated, Yeast
Biozol Catalog Number: BIM-RPC29754
Supplier Catalog Number: RPC29754
Alternative Catalog Number: BIM-RPC29754-20UG,BIM-RPC29754-100UG,BIM-RPC29754-1MG
Manufacturer: Biomatik Corporation
Host: Yeast
Category: Proteine/Peptide
Species Reactivity: Bacteria
Conjugation: Unconjugated
Alternative Names: IFN-gamma
Accession Number: P63309; IFNG. Activity: Not Tested. Endotoxin Level: Not Tested. Expiration: 12 months. Expression Region: 24-165aa. Protein Length: Full Length of Mature Protein. Protein Type: Recombinant Protein. Quality Guarantee: This product carries the Biomatik 100% Quality Guarantee. Please refer to the Terms and Conditions for details. Quality Systems: This product is manufactured at ISO 9001 certified facilities. Reconstitution: Refer to the datasheet/CoA included in the product pouch. Research Area: Cancer. Shipping Condition: Ice packs. Short Description: Recombinant Macaca fascicularis Interferon gamma (IFNG) is a purified Recombinant Protein
Molecular Weight: 18.3kDa
Tag: C-Terminal 6xHis-Tagged
Purity: >90% by SDS-PAGE
Sequence: QDPYVKEAENLKKYFNAGDPDVADNGTLFLDILRNWKEESDRKIMQSQIVSFYFKLFKNFKDDQRIQKSVETIKEDINVKFFNSNKKKRDDFEKLTNYSVTDSNVQRKAVHELIQVMAELSPAAKIGKRKRSQMFRGRRASQ
Target: Interferon gamma (IFNG)