Recombinant Human Interleukin-12 subunit beta (IL12B), Unconjugated, Yeast

Product Overview

• Article Name: Recombinant Human Interleukin-12 subunit beta (IL12B), Unconjugated, Yeast
• Biozol Catalog Number: BIM-RPC29755
• Supplier Catalog Number: RPC29755
• Alternative Catalog Number: BIM-RPC29755-20UG,BIM-RPC29755-100UG,BIM-RPC29755-1MG
• Manufacturer: Biomatik Corporation
• Host: Yeast
• Category: Proteine/Peptide
• Species Reactivity: Human
• Conjugation: Unconjugated
• Alternative Names: Cytotoxic lymphocyte maturation factor 40 kDa subunit, CLMF p40, IL-12 subunit p40, NK cell stimulatory factor chain 2, NKSF2

Product Description

Accession Number: P29460; IL12B. Activity: Not Tested. Endotoxin Level: Not Tested. Expiration: 12 months. Expression Region: 23-328aa. Protein Length: Full Length of Mature Protein. Protein Type: Recombinant Protein. Quality Guarantee: This product carries the Biomatik 100% Quality Guarantee. Please refer to the Terms and Conditions for details. Quality Systems: This product is manufactured at ISO 9001 certified facilities. Reconstitution: Refer to the datasheet/CoA included in the product pouch. Research Area: Immunology. Shipping Condition: Ice packs. Short Description: Recombinant Human Interleukin-12 subunit beta (IL12B) is a purified Recombinant Protein

Product Properties

• Molecular Weight: 36.8kDa
• Tag: C-Terminal 6xHis-Tagged
• Purity: >85% by SDS-PAGE
• Sequence: IWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPQGVTCGAATLSAERVRGDNKEYEYSVECQEDSACPAAEESLPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKNLQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQ
• Target: Interleukin-12 subunit beta (IL12B)