Recombinant Mouse Complement receptor type 2 (Cr2), partial, Unconjugated, E. coli

Product Overview

• Article Name: Recombinant Mouse Complement receptor type 2 (Cr2), partial, Unconjugated, E. coli
• Biozol Catalog Number: BIM-RPC29760
• Supplier Catalog Number: RPC29760
• Alternative Catalog Number: BIM-RPC29760-20UG,BIM-RPC29760-100UG,BIM-RPC29760-1MG
• Manufacturer: Biomatik Corporation
• Host: E. coli
• Category: Proteine/Peptide
• Species Reactivity: Mouse
• Conjugation: Unconjugated
• Alternative Names: Complement C3d receptor, CD_antigen: CD21

Product Description

Accession Number: P19070; Cr2. Activity: Not Tested. Endotoxin Level: Not Tested. Expiration: 12 months. Expression Region: 12-145aa. Protein Length: Partial. Protein Type: Recombinant Protein. Quality Guarantee: This product carries the Biomatik 100% Quality Guarantee. Please refer to the Terms and Conditions for details. Quality Systems: This product is manufactured at ISO 9001 certified facilities. Reconstitution: Refer to the datasheet/CoA included in the product pouch. Research Area: Immunology. Shipping Condition: Ice packs. Short Description: Recombinant Mouse Complement receptor type 2 (Cr2), partial is a purified Recombinant Protein

Product Properties

• Molecular Weight: 18.7kDa
• Tag: N-Terminal 6xHis-Tagged
• Purity: >90% by SDS-PAGE
• Sequence: ISCDPPPEVKNARKPYYSLPIVPGTVLRYTCSPSYRLIGEKAIFCISENQVHATWDKAPPICESVNKTISCSDPIVPGGFMNKGSKAPFRHGDSVTFTCKANFTMKGSKTVWCQANEMWGPTALPVCESDFPLE
• Target: Complement receptor type 2 (Cr2)