Recombinant Influenza A virus Matrix protein 2 (M), Unconjugated

Catalog Number: BIM-RPC29762
Article Name: Recombinant Influenza A virus Matrix protein 2 (M), Unconjugated
Biozol Catalog Number: BIM-RPC29762
Supplier Catalog Number: RPC29762
Alternative Catalog Number: BIM-RPC29762-20UG,BIM-RPC29762-100UG
Manufacturer: Biomatik Corporation
Category: Proteine/Peptide
Species Reactivity: Virus
Conjugation: Unconjugated
Alternative Names: Proton channel protein M2
Accession Number: A4GCM0; M. Activity: Not Tested. Endotoxin Level: Not Tested. Expiration: 12 months. Expression Region: 1-97aa. Protein Length: Full Length. Protein Type: CF Transmembrane Protein. Quality Guarantee: This product carries the Biomatik 100% Quality Guarantee. Please refer to the Terms and Conditions for details. Quality Systems: This product is manufactured at ISO 9001 certified facilities. Reconstitution: Refer to the datasheet/CoA included in the product pouch. Research Area: Others. Shipping Condition: Ice packs. Short Description: Recombinant Influenza A virus Matrix protein 2 (M) is a purified CF Transmembrane Protein. Host Notes: in vitro E. coli expression system
Molecular Weight: 17.2kDa
Tag: N-Terminal 10xHis-Tagged
Purity: >90% by SDS-PAGE
Sequence: MSLLTEVETPIRNEWGCRCNGSSDPLVIAASIIGILHLILWILDRLLFKCIYRRFKYGLKRGPSTEGVPESMREEYRKEQQSAVDADDGHFVNIEPE
Target: Matrix protein 2 (M)