Recombinant Vaccinia virus Protein K3 (K3L), Unconjugated, E. coli

Catalog Number: BIM-RPC29763
Article Name: Recombinant Vaccinia virus Protein K3 (K3L), Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC29763
Supplier Catalog Number: RPC29763
Alternative Catalog Number: BIM-RPC29763-20UG,BIM-RPC29763-100UG,BIM-RPC29763-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Virus
Conjugation: Unconjugated
Alternative Names: K3L, Protein K3
Accession Number: P20639; K3L. Activity: Not Tested. Endotoxin Level: Not Tested. Expiration: 12 months. Expression Region: 1-88aa. Protein Length: Full Length. Protein Type: Recombinant Protein. Quality Guarantee: This product carries the Biomatik 100% Quality Guarantee. Please refer to the Terms and Conditions for details. Quality Systems: This product is manufactured at ISO 9001 certified facilities. Reconstitution: Refer to the datasheet/CoA included in the product pouch. Research Area: Others. Shipping Condition: Ice packs. Short Description: Recombinant Vaccinia virus Protein K3 (K3L) is a purified Recombinant Protein
Molecular Weight: 26.5kDa
Tag: N-Terminal 6xHis-SUMO-Tagged
Purity: >90% by SDS-PAGE
Sequence: MLAFCYSLPNAGDVIKGRVYEKDYALYIYLFDYPHSEAILAESVKMHMDRYVEYRDKLVGKTVKVKVIRVDYTKGYIDVNYKRMCRHQ
Target: Protein K3 (K3L)