Recombinant E. coli Cytolethal distending toxin subunit A (cdtA), Unconjugated

Catalog Number: BIM-RPC29765
Article Name: Recombinant E. coli Cytolethal distending toxin subunit A (cdtA), Unconjugated
Biozol Catalog Number: BIM-RPC29765
Supplier Catalog Number: RPC29765
Alternative Catalog Number: BIM-RPC29765-20UG,BIM-RPC29765-100UG,BIM-RPC29765-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: E. coli
Conjugation: Unconjugated
Alternative Names: Cytolethal distending toxin subunit A, CDT A
Accession Number: Q46668; cdtA. Activity: Not Tested. Endotoxin Level: Not Tested. Expiration: 12 months. Expression Region: 22-258aa. Protein Length: Full Length of Mature Protein. Protein Type: Recombinant Protein. Quality Guarantee: This product carries the Biomatik 100% Quality Guarantee. Please refer to the Terms and Conditions for details. Quality Systems: This product is manufactured at ISO 9001 certified facilities. Reconstitution: Refer to the datasheet/CoA included in the product pouch. Research Area: Others. Shipping Condition: Ice packs. Short Description: Recombinant E. coli Cytolethal distending toxin subunit A (cdtA) is a purified Recombinant Protein
Molecular Weight: 29.5kDa
Tag: N-Terminal 6xHis-Tagged
Purity: >85% by SDS-PAGE
Sequence: CSSGKNKAYLDPKVFPPQVEGGPTVPSPDEPGLPLPGPGPALPTNGAIPIPEPGTAPAVSLMNMDGSVLTMWSRGAGSSLWAYYIGDSNSFGELRNWQIMPGTRPNTIQFRNVDVGTCMTSFPGFKGGVQLSTAPCKFGPERFDFQPMATRNGNYQLKSLSTGLCIRANFLGRTPSSPYATTLTMERCPSSGEKNFEFMWSISEPLRPALATIAKPEIRPFPPQPIEPDEHSTGGEQ
Target: Cytolethal distending toxin subunit A (cdtA)