Human recombinant VEGF165 (Vascular endothelial growth factor 165) protein, AF

Catalog Number: BOB-PROTP15692-18-100UG
Article Name: Human recombinant VEGF165 (Vascular endothelial growth factor 165) protein, AF
Biozol Catalog Number: BOB-PROTP15692-18-100UG
Supplier Catalog Number: PROTP15692-18-100ug
Alternative Catalog Number: BOB-PROTP15692-18-100UG-100UG
Manufacturer: Boster Bio
Category: Proteine/Peptide
Application: Cell Culture
Species Reactivity: Human
Alternative Names: VPF, Folliculostellate cell-derived growth factor, Glioma-derived endothelial cell mitogen
Vascular Endothelial Growth Factors 165(VEGF165) is a potent growth and angiogenic cytokine which belongs to the VEGF family, includes VEGF-A, VEGF-B, VEGF-C, VEGF-D, VEGF-E, and PIGF. Human VEGF165 is an abundant glycosylated cytokine composed of two identical 165 amino acid chains. Human VEGF165 plays an important role in embryonic vasculogenesis, angiogenesis and neurogenesis.
Molecular Weight: The protein has a calculated MW of 20.11 kDa. The protein migrates as 21 kDa under reducing condition (SDS-PAGE analysis).
Tag: His Tag (C-term)
UniProt: P15692
Source: Escherichia coli
Form: The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 8.0. If you have any concerns or special requirements, please confirm with us.
Sequence: MAPMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQENPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR with polyhistidine tag at the C-terminus.