Mouse recombinant CXCL9 (C-X-C motif chemokine 9) protein, AF

Product Overview

• Article Name: Mouse recombinant CXCL9 (C-X-C motif chemokine 9) protein, AF
• Biozol Catalog Number: BOB-PROTP18340-1-5UG
• Supplier Catalog Number: PROTP18340-1-5ug
• Alternative Catalog Number: BOB-PROTP18340-1-5UG-5UG
• Manufacturer: Boster Bio
• Category: Proteine/Peptide
• Application: Cell Culture
• Species Reactivity: Mouse
• Alternative Names: Monokine Induced by Interferon-gamma, MIG

Product Description

C-X-C motif chemokine 9 (CXCL9) also named monokine induced by gamma interferon (MIG), which is a chemokine of the intercrine alpha family. CXCL9 is a 11.7 kDa protein containing 10? amino acid residues. CXCL9 controls the immune cells by binding the CXCR3 which is including the cell migration and activation. During inflammation, CXCL9 is a chemotaxis for lymphocyte and macrophages. CXCL9 is participated in the process of tumor proliferation and metastasis.

Product Properties

• Molecular Weight: The protein has a calculated MW of 13.00 kDa. The protein migrates as 11-17 kDa under reducing condition (SDS-PAGE analysis).
• Tag: His Tag (N-term)
• UniProt: P18340
• Source: Escherichia coli
• Form: The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 7.4. If you have any concerns or special requirements, please confirm with us.
• Sequence: TLVIRNARCSCISTSRGTIHYKSLKDLKQFAPSPNCNKTEIIATLKNGDQTCLDPDSANVKKLMKEWEKKINQKKKQKRGKKHQKNMKNRKPKTPQSRRRSRKTT with polyhistidine tag at the N-terminus.