RAB22A Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage

Catalog Number: BYT-ORB2101643
Article Name: RAB22A Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2101643
Supplier Catalog Number: orb2101643
Alternative Catalog Number: BYT-ORB2101643-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: IHC, WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human RAB22A
Conjugation: HRP
Alternative Names: MGC16770
RAB22A Rabbit Polyclonal Antibody (HRP)
Clonality: Polyclonal
Molecular Weight: 22kDa
NCBI: 065724
UniProt: P35285
Buffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Form: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequence: Synthetic peptide located within the following region: IFVETSAKNAININELFIEISRRIPSTDANLPSGGKGFKLRRQPSEPKRS