Porcine PSAP protein
Catalog Number:
BYT-ORB605375
- Images (3)
| Article Name: | Porcine PSAP protein |
| Biozol Catalog Number: | BYT-ORB605375 |
| Supplier Catalog Number: | orb605375 |
| Alternative Catalog Number: | BYT-ORB605375-20,BYT-ORB605375-100,BYT-ORB605375-1 |
| Manufacturer: | Biorbyt |
| Category: | Proteine/Peptide |
| Alternative Names: | Cerebroside sulfate activator (CS-ACT) (Non-specific activator) (Sphingolipid activator protein 1) (SAP-1) |
| This Porcine PSAP protein spans the amino acid sequence from region 1-80aa. Purity: Greater than 90% as determined by SDS-PAGE. |
| Molecular Weight: | 11.9 kDa |
| UniProt: | P81405 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | Sus scrofa (Pig) |
| Purity: | Greater than 90% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | GDVCQDCIQMVTDLQNAVRTNSTFVEALVNHAKEECDRLGPGMADMCKNYISQYSEIAIQMMMHMQPKDICGLVGFCEEV |
| Application Notes: | Biological Origin: Sus scrofa (Pig). Application Notes: Full Length |
|
|
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel. |
|
|
Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Yeast-expressed Sus scrofa (Pig) PSAP. |
|
|
Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Yeast-expressed Sus scrofa (Pig) PSAP. |
Product Guarantee and Expert Support
