Bacteria ltxA protein

Product Overview

• Article Name: Bacteria ltxA protein
• Biozol Catalog Number: BYT-ORB605424
• Supplier Catalog Number: orb605424
• Alternative Catalog Number: BYT-ORB605424-20,BYT-ORB605424-100,BYT-ORB605424-1
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Alternative Names: AaLta lktA

Product Description

This Bacteria ltxA protein spans the amino acid sequence from region 721-1055aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Properties

• Molecular Weight: 38.3 kDa
• UniProt: P16462
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: Aggregatibacter actinomycetemcomitans (Actinobacillus actinomycetemcomitans) (Haemophilus actinomycetemcomitans)
• Purity: Greater than 85% as determined by SDS-PAGE.
• Form: Liquid or Lyophilized powder
• Sequence: IGSTLRDKFYGSKFNDVFHGHDGDDLIYGYDGDDRLYGDNGNDEIHGGQGNDKLYGGAGNDRLFGEYGNNYLDGGEGDDHLEGGNGSDILRGGSGNDKLFGNQGDDLLDGGEGDDQLAGGEGNDIYVYRKEYGHHTITEHSGDKDKLSLANINLKDVSFERNGNDLLLKTNNRTAVTFKGWFSKPNSSAGLDEYQRKLLEYAPEKDRARLKRQFELQRGKVDKSLNNKVEEIIGKDGERITSQDIDNLFDKSGNK

Application Notes

• Application Notes: Biological Origin: Aggregatibacter actinomycetemcomitans (Actinobacillus actinomycetemcomitans) (Haemophilus actinomycetemcomitans). Application Notes: Partial

Images

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.The reducing (R) protein migrates as 55 kDa in SDS-PAGE may be due to glycosylation.Recommended Product

Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Yeast-expressed Aggregatibacter actinomycetemcomitans (Actinobacillus actinomycetemcomitans) (Haemophilus actinomycetemcomitans) ltxA.

Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Yeast-expressed Aggregatibacter actinomycetemcomitans (Actinobacillus actinomycetemcomitans) (Haemophilus actinomycetemcomitans) ltxA.