Bacteria fim3 protein

Product Overview

• Article Name: Bacteria fim3 protein
• Biozol Catalog Number: BYT-ORB605425
• Supplier Catalog Number: orb605425
• Alternative Catalog Number: BYT-ORB605425-20,BYT-ORB605425-100,BYT-ORB605425-1
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Alternative Names: fim3, BP1568, Serotype 3 fimbrial subunit

Product Description

This Bacteria fim3 protein spans the amino acid sequence from region 26-204aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Properties

• Molecular Weight: 21.2 kDa
• UniProt: P17835
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
• Purity: Greater than 85% as determined by SDS-PAGE.
• Form: Liquid or Lyophilized powder
• Sequence: NDGTIVITGSISDQTCVIEEPSTLNHIKVVQLPKISKNALRNDGDTAGATPFDIKLKECPQALGALKLYFEPGITTNYDTGDLIAYKQTYNASGNGNLSTVSSATKAKGVEFRLANLNGQHIRMGTDKTTQAAQTFTGKVTNGSKSYTLRYLASYVKKPKEDVDAAQITSYVGFSVVYP

Application Notes

• Application Notes: Biological Origin: Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251). Application Notes: Full Length of Mature Protein

Images

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Yeast-expressed Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) fim3.

Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Yeast-expressed Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) fim3.