Recombinant Mouse Tumor necrosis factor ligand superfamily member 4 (Tnfsf4), partial

Catalog Number: CSB-MP023994MO1
Article Name: Recombinant Mouse Tumor necrosis factor ligand superfamily member 4 (Tnfsf4), partial
Biozol Catalog Number: CSB-MP023994MO1
Supplier Catalog Number: CSB-MP023994MO1
Alternative Catalog Number: CSB-MP023994MO1-1, CSB-MP023994MO1-100, CSB-MP023994MO1-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: OX40 ligand
Molecular Weight: 42.9 kDa
Tag: N-terminal hFc1-tagged
UniProt: P43488
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Mammalian cell
Expression System: 49-198aa
Purity: Greater than 95% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: QLSSSPAKDPPIQRLRGAVTRCEDGQLFISSYKNEYQTMEVQNNSVVIKCDGLYIIYLKGSFFQEVKIDLHFREDHNPISIPMLNDGRRIVFTVVASLAFKDKVYLTVNAPDTLCEHLQINDGELIVVQLTPGYCAPEGSYHSTVNQVPL