Anti-NPF Receptor (N-term) Antibody, Polyclonal

Product Overview

• Article Name: Anti-NPF Receptor (N-term) Antibody, Polyclonal
• Biozol Catalog Number: RAY-RB-19-0003-20
• Supplier Catalog Number: RB-19-0003-20
• Alternative Catalog Number: RAY-RB-19-0003-20
• Manufacturer: RayBiotech
• Category: Antikörper
• Immunogen: Immunogen is a synthetic peptide derived from Drosophila Neuropeptide F. This antibody was produced from a rabbit immunized with the immunogen. The IgG fraction was purified from rabbit serum by ammonium sulphate precipitation, and followed by Protein A/G affinity chromatography.

Product Description

Rabbit Anti-NPF Receptor (N-terminus) Antibody

Product Properties

• Clonality: Polyclonal
• UniProt: NP_524245
• Sequence: YNKLKSRITVVAVQASSAQRKVERGRRMKRTNC

Application Notes

• Application Notes: ELISA (recommended work dilution= 1: 1,000-5,000)