DDIT3/CHOP Rabbit pAb, Unconjugated

Produktübersicht

• Artikelname: DDIT3/CHOP Rabbit pAb, Unconjugated
• Artikelnummer: ABB-A0221
• Hersteller Artikelnummer: A0221
• Alternativnummer: ABB-A0221-100UL,ABB-A0221-20UL,ABB-A0221-1000UL,ABB-A0221-500UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, IF, IHC-P, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: CHOP, CEBPZ, CHOP10, CHOP-10, GADD153, AltDDIT3, C/EBPzeta, DDIT3/CHOP

Produktbeschreibung

This gene encodes a member of the CCAAT/enhancer-binding protein (C/EBP) family of transcription factors. The protein functions as a dominant-negative inhibitor by forming heterodimers with other C/EBP members, such as C/EBP and LAP (liver activator protein), and preventing their DNA binding activity. The protein is implicated in adipogenesis and erythropoiesis, is activated by endoplasmic reticulum stress, and promotes apoptosis. Fusion of this gene and FUS on chromosome 16 or EWSR1 on chromosome 22 induced by translocation generates chimeric proteins in myxoid liposarcomas or Ewing sarcoma. Multiple alternatively spliced transcript variants encoding two isoforms with different length have been identified.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 19kDa
• NCBI: 1649
• UniProt: P35638
• Reinheit: Affinity purification
• Sequenz: MAAESLPFSFGTLSSWELEAWYEDLQEVLSSDENGGTYVSPPGNEEEESKIFTTLDPASLAWLTEEEPEPAEVTSTSQSPHSPDSSQSSLAQEEEEEDQGRTRKRKQSGHSPARAGKQRMKEKEQENERKVAQLAEENERLKQEIERLTREVEATRRALIDRMVNLHQA
• Target-Kategorie: DDIT3
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:1000 - 1:5000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Transcription Factors,Signal Transduction,Cell Biology Developmental Biology,Autophagy,Endocrine Metabolism,Endocrine and metabolic diseases,Diabetes,Obesity,Stem Cells,Embryonic Stem Cells

Bilder