CLIC4, Recombinant, Human, aa1-253, GST-Tag (Chloride Intracellular Channel Protein 4)

Produktübersicht

• Artikelname: CLIC4, Recombinant, Human, aa1-253, GST-Tag (Chloride Intracellular Channel Protein 4)
• Artikelnummer: USB-372787
• Hersteller Artikelnummer: 372787
• Alternativnummer: USB-372787-20,USB-372787-100,USB-372787-1
• Hersteller: US Biological
• Kategorie: Molekularbiologie

Produktbeschreibung

Can insert into membranes and form poorly selective ion channels that may also transport chloride ions. Channel activity depends on the pH. Membrane insertion seems to be redox-regulated and may occur only under oxydizing conditions. Promotes cell-surface expression of HRH3. Has alternate cellular functions like a potential role in angiogenesis or in maintaining apical-basolateral membrane polarity during mitosis and cytokinesis. Could also promote endothelial cell proliferation and regulate endothelial morphogenesis (tubulogenesis). Source: Recombinant protein corresponding to aa1-253 from human CLIC4, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~55.8kD Amino Acid Sequence: MALSMPLNGLKEEDKEPLIELFVKAGSDGESIGNCPFSQRLFMILWLKGVVFSVTTVDLKRKPADLQNLAPGTHPPFITFNSEVKTDVNKIEEFLEEVLCPPKYLKLSPKHPESNTAGMDIFAKFSAYIKNSRPEANEALERGLLKTLQKLDEYLNSPLPDEIDENSMEDIKFSTRKFLDGNEMTLADCNLLPKLHIVKVVAKKYRNFDIPKEMTGIWRYLTNAYSRDEFTNTCPSDKEVEIAYSDVAKRLTK Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Produkteigenschaften

• Molekulargewicht: 55.8
• UniProt: Q9Y696
• Reinheit: 90% (SDS-PAGE)
• Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.