Produktbeschreibung
The three mammalian isoforms of TGF-beta, TGF-beta1, beta2, beta3, signal through the same receptor and elicit similar biological responses. They are multifunctional cytokines that regulate cell proliferation, growth, differentiation and motility as well as synthesis and deposition of the extracellular matrix. They are involved in various physiological processes including embryogenesis, tissue remodeling and would healing. They are secreted predominantly as latent complexes which are stored at the cell surface and in the extracellular matrix. The release of biologically active TGF-beta isoform from a latent complex involves proteolytic processing of the complex and /or induction of conformational changes by proteins such as thrombospondin-1. TGF-beta1 is the most abundant isoform secreted by almost every cell type. It was originally identified for its ability to induce phenotypic transformation of fibroblasts and recently it has been implicated in the formation of skin tumors. Human TGF-beta 1 is a 25kD protein with each subunit containing 112 amino acid residues, linked by a single disulfide bond. Recombinant protein corresponding to human TGF-b1 expressed in CHO cells. Amino Acid Sequence: ALDTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASAAPCCVPQALEPLPIVYGRKPKVEQLSNMIVRSCKCS Biological Activity: The ED50 is determined by TGF-b1 ability to inhibit the mouse IL-4-dependent proliferation of mouse HT-2 cells is 0.05ng/ml Specific Activity: 2x10e7 units/mg Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. It is recommended that further dilutions be made in PBS, 0.1% BSA or HSA. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
* MwSt. und Versandkosten nicht enthalten. Irrtümer und Preisänderungen vorbehalten
