NQO1 Rabbit pAb, Unconjugated
Artikelnummer:
ABB-A0047
- Bilder (2)
| Artikelname: | NQO1 Rabbit pAb, Unconjugated |
| Artikelnummer: | ABB-A0047 |
| Hersteller Artikelnummer: | A0047 |
| Alternativnummer: | ABB-A0047-20UL,ABB-A0047-100UL,ABB-A0047-1000UL,ABB-A0047-500UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, IF, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | DTD, QR1, DHQU, DIA4, NMOR1, NMORI, NQO1 |
| This gene is a member of the NAD(P)H dehydrogenase (quinone) family and encodes a cytoplasmic 2-electron reductase. This FAD-binding protein forms homodimers and reduces quinones to hydroquinones. This proteins enzymatic activity prevents the one electron reduction of quinones that results in the production of radical species. Mutations in this gene have been associated with tardive dyskinesia (TD), an increased risk of hematotoxicity after exposure to benzene, and susceptibility to various forms of cancer. Altered expression of this protein has been seen in many tumors and is also associated with Alzheimers disease (AD). Alternate transcriptional splice variants, encoding different isoforms, have been characterized. |
| Molekulargewicht: | 31kDa |
| NCBI: | 1728 |
| UniProt: | P15559 |
| Reinheit: | Affinity purification |
| Sequenz: | MVGRRALIVLAHSERTSFNYAMKEAAAAALKKKGWEVVESDLYAMNFNPIISRKDITGKLKDPANFQYPAESVLAYKEGHLSPDIVAEQKKLEAADLVIFQFPLQWFGVPAILKGWFERVFIGEFAYTYAAMYDKGPFRSKKAVLSITTGGSGSMYSLQGIHGDMNVILWPIQSGILHFCGFQVLEPQLTYSIGHTPADARIQILEGWKKRLENIWDETPLYFAPSSLFDLNFQAGFLMKKEVQDEEKNKKFGLS |
| Target-Kategorie: | NQO1 |
| Application Verdünnung: | WB,1:100 - 1:500|IF/ICC,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human,Mouse,Rat, ResearchArea: Epigenetics Nuclear Signaling,RNA Binding,Cancer,Signal Transduction,Endocrine Metabolism,Drug metabolism. |


