CYP1A2 Rabbit pAb, Unconjugated

Artikelnummer: ABB-A0062
Artikelname: CYP1A2 Rabbit pAb, Unconjugated
Artikelnummer: ABB-A0062
Hersteller Artikelnummer: A0062
Alternativnummer: ABB-A0062-100UL,ABB-A0062-20UL,ABB-A0062-500UL,ABB-A0062-1000UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, IF, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: CP12, CYPIA2, P3-450, P450(PA), CYP1A2
This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. The protein encoded by this gene localizes to the endoplasmic reticulum and its expression is induced by some polycyclic aromatic hydrocarbons (PAHs), some of which are found in cigarette smoke. The enzymes endogenous substrate is unknown, however, it is able to metabolize some PAHs to carcinogenic intermediates. Other xenobiotic substrates for this enzyme include caffeine, aflatoxin B1, and acetaminophen. The transcript from this gene contains four Alu sequences flanked by direct repeats in the 3 untranslated region.
Klonalität: Polyclonal
Molekulargewicht: 58kDa
NCBI: 1544
UniProt: P05177
Reinheit: Affinity purification
Sequenz: FGQHFPESSDEMLSLVKNTHEFVETASSGNPLDFFPILRYLPNPALQRFKAFNQRFLWFLQKTVQEHYQDFDKNSVRDITGALFKHSKKGPRASGNLIPQE
Target-Kategorie: CYP1A2
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:2000|IF-P,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat, ResearchArea: Cancer,Signal Transduction,Endocrine Metabolism,Mitochondrial metabolism,Lipid Metabolism,Lipases,Drug metabolism,Cardiovascular,Lipids.
Immunofluorescence analysis of paraffin-embedded human liver using CYP1A2 Rabbit pAb (A0062) at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
Immunofluorescence analysis of paraffin-embedded mouse liver using CYP1A2 Rabbit pAb (A0062) at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
Western blot analysis of various lysates using CYP1A2 Rabbit pAb (A0062) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.
Immunofluorescence analysis of paraffin-embedded rat liver using CYP1A2 Rabbit pAb (A0062) at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.