Anti-GFP Antibody - Identical to Abcam (ab290), Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A290-50
Artikelname: Anti-GFP Antibody - Identical to Abcam (ab290), Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A290-50
Hersteller Artikelnummer: A290-50
Alternativnummer: ABC-A290-50
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, EM, FC, ICC, IHC-Fr, IHC-P, IP, WB
Spezies Reaktivität: All
Immunogen: Recombinant full-length protein corresponding to Green Fluorescent Protein (GFP) from Aequorea victoria.
Konjugation: Unconjugated
Rabbit polyclonal antibody to GFP.
Klonalität: Polyclonal
Puffer: Supplied as an aliquot of serum with 0.05% Sodium Azide and 1.25% Sodium Chloride.
Reinheit: Whole antiserum.
Formulierung: Liquid
Sequenz: MSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTFSYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITHGMDELYK
Target-Kategorie: GFP
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:1,000-1:2,500, ICC: 1:200-1:1,000, Flow Cytometry: 1:100, IHC-P: 1:500-1:1,000, IHC-Fr: 1:500-1:2,000, Electron Microscopy: 1:1,000-1:4,000