Anti-CHGA
Artikelnummer:
ATA-AMAB90525
- Bilder (9)
| Artikelname: | Anti-CHGA |
| Artikelnummer: | ATA-AMAB90525 |
| Hersteller Artikelnummer: | AMAb90525 |
| Alternativnummer: | ATA-AMAB90525-100,ATA-AMAB90525-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Mouse |
| Kategorie: | Sonstiges |
| Applikation: | ICC, IHC, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | Pan-Cancer |
| chromogranin A (parathyroid secretory protein 1) |
| Anti-CHGA |
| Klonalität: | Monoclonal |
| Konzentration: | 1 |
| Klon-Bezeichnung: | [CL0166] |
| Isotyp: | IgG1 |
| NCBI: | 1113 |
| UniProt: | P10645 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Protein A purified |
| Sequenz: | NSPMNKGDTEVMKCIVEVISDTLSKPSPMPVSQECFETLRGDERILSILRHQNLLKELQDLALQGAKERAHQQKKHSGFEDELSEVLENQSSQAELKEAVEEPSSKDVMEKREDSKEAEKSGEATDGARPQALPEPMQESK |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | CHGA |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | ICC-IF: 2-10 µg/ml, IHC: 1:1000 - 1:2500, WB: 1 µg/ml |
|
|
Immunohistochemical staining of human pancreas shows strong positivity in endocrine islets of Langerhans. |
|
|
Immunohistochemical staining of human colon shows strong reactivity in a subset of enteroendocrine cells. |
|
|
Immunohistochemical staining of human duodenum shows strong positivity in a subset of enteroendocrine cells. |
|
|
Lane 1: Marker [kDa] Lane 2: Negative control (vector only transfected HEK293T lysate) Lane 3: CHGA Over-expression Lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY400511) |
|
|
AMAb90525-100ul |
|
|
|
|
|
|
|
|
AMAb90525-100ul |
|
|
AMAb90525-100ul |
Produktgarantie und fachkundiger Support
