Anti-CA12

Artikelnummer: ATA-AMAB90637
Artikelname: Anti-CA12
Artikelnummer: ATA-AMAB90637
Hersteller Artikelnummer: AMAb90637
Alternativnummer: ATA-AMAB90637-100,ATA-AMAB90637-25
Hersteller: Atlas Antibodies
Wirt: Mouse
Kategorie: Sonstiges
Applikation: IHC, WB
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: HsT18816
carbonic anhydrase XII
Anti-CA12
Klonalität: Monoclonal
Konzentration: 1
Klon-Bezeichnung: [CL0278]
Isotyp: IgG2a
NCBI: 771
UniProt: O43570
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Protein A purified
Sequenz: TASNKSEGLAVLAVLIEMGSFNPSYDKIFSHLQHVKYKGQEAFVPGFNIEELLPERTAEYYRYRGSLTTPPCNPTVLWTVFRNPVQISQEQLLALETALYCTHMDDPSPREMINNFRQVQ
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: CA12
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:2500 - 1:5000, WB: 1 µg/ml
Immunohistochemical staining of human kidney shows strong membranous immunoreactivity in renal tubules, but not glomeruli.
Immunohistochemical staining of human rectum shows strong membranous positivity in glandular epithelial cells.
Immunohistochemical staining of human stomach shows moderate membranous immunoreactivity in glandular cells.
Immunohistochemical staining of human renal cancer shows membranous positivity in tumor cells.
Lane 1: Marker [kDa]
Lane 2: Human tonsil tissue lysate
AMAb90637-100ul
AMAb90637-100ul
AMAb90637-100ul