Anti-APOA4
Artikelnummer:
ATA-AMAB90768
- Bilder (9)
| Artikelname: | Anti-APOA4 |
| Artikelnummer: | ATA-AMAB90768 |
| Hersteller Artikelnummer: | AMAb90768 |
| Alternativnummer: | ATA-AMAB90768-100,ATA-AMAB90768-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Mouse |
| Kategorie: | Sonstiges |
| Applikation: | IHC, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | APOA4 |
| apolipoprotein A-IV |
| Anti-APOA4 |
| Klonalität: | Monoclonal |
| Konzentration: | 0.1 |
| Klon-Bezeichnung: | [CL0467] |
| Isotyp: | IgG1 |
| NCBI: | 337 |
| UniProt: | P06727 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Protein A purified |
| Sequenz: | LEGLTFQMKKNAEELKARISASAEELRQRLAPLAEDVRGNLRGNTEGLQKSLAELGGHLDQQVEEFRRRVEPYGENFNKALVQQMEQLRQKLGPHAGDVEGHLSFLEKDLRDKVNSFFSTFKEKESQDKTLSLP |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | APOA4 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:2500 - 1:5000, WB: 1 µg/ml |
|
|
Immunohistochemical staining of human colon shows strong strong immunoreactivity in plasma in a large blood vessel. |
|
|
Immunohistochemical staining of human kidney shows strong cytoplasmic immunoreactivity in a subset of renal tubules. |
|
|
Immunohistochemical staining of human cerebral cortex shows strong positivity in blood vessels. |
|
|
Immunohistochemical staining of human pancreas shows absence of immunoreactivity (negative control). |
|
|
Lane 1: Marker [kDa] Lane 2: Human plasma |
|
|
AMAb90768-100ul |
|
|
|
|
|
AMAb90768-100ul |
|
|
AMAb90768-100ul |
Produktgarantie und fachkundiger Support
