ACTH (7-38), human / Corticotropin Inhibiting Peptide (7-38), human

Artikelnummer: ECH-111-45
Artikelname: ACTH (7-38), human / Corticotropin Inhibiting Peptide (7-38), human
Artikelnummer: ECH-111-45
Hersteller Artikelnummer: 111-45
Alternativnummer: ECH-111-45-1MG, ECH-111-45-5MG
Hersteller: Echelon Biosciences
Kategorie: Molekularbiologie
CAS Number: 68563-24-6 Molecular Weight: 3656.92 Salt Form: TFA Purity: >96% Sequence (3-letter): Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-Arg-Arg-Pro-Val-Lys-Val-Tyr-Pro-Asn-Gly-Ala-Glu-Asp-Glu-Ser-Ala-Glu-Ala-Phe-Pro-Leu-Glu-OH Sequence (1-letter): FRWGKPVGKKRRPVKVYPNGAEDESAEAFPLE-OH Storage: -20 ?C or below ACTH (7-38) or Corticotropin Inhibiting Peptide (CIP) (7-38) is a fragment of Adrenocorticotropic Hormone which inhibits ACTH stimulated adenylate cyclase. It can acts as an antagonist of ACTH receptors.
Anwendungsbeschreibung: Categories: Peptides. Related: Neuropeptides & Hormones. Ship 1 : Shipping Temp. Ship 2: Ambient Temperature