Cytokeratin 4 (KRT4) Rabbit mAb, Unconjugated

Catalog Number: ABB-A0013
Article Name: Cytokeratin 4 (KRT4) Rabbit mAb, Unconjugated
Biozol Catalog Number: ABB-A0013
Supplier Catalog Number: A0013
Alternative Catalog Number: ABB-A0013-20UL,ABB-A0013-100UL,ABB-A0013-1000UL,ABB-A0013-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, IF, IHC-P, WB
Species Reactivity: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: K4, CK4, CK-4, CYK4, WSN1, Cytokeratin 4 (KRT4)
The protein encoded by this gene is a member of the keratin gene family. The type II cytokeratins consist of basic or neutral proteins which are arranged in pairs of heterotypic keratin chains coexpressed during differentiation of simple and stratified epithelial tissues. This type II cytokeratin is specifically expressed in differentiated layers of the mucosal and esophageal epithelia with family member KRT13. Mutations in these genes have been associated with White Sponge Nevus, characterized by oral, esophageal, and anal leukoplakia. The type II cytokeratins are clustered in a region of chromosome 12q12-q13.
Clonality: Monoclonal
Clone Designation: [ARC1804]
Molecular Weight: 56kDa
NCBI: 3851
UniProt: P19013
Purity: Affinity purification
Sequence: MIARQQCVRGGPRGFSCGSAIVGGGKRGAFSSVSMSGGAGRCSSGGFGSRSLYNLRGNKSISMSVAGSRQGACFGGAGGFGTGGFGGGFGGSFSGKGGPG
Target: KRT4
Antibody Type: Primary Antibody
Application Dilute: WB,1:1000 - 1:4000|IF-P,1:100 - 1:400|IHC-P,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse, ResearchArea: Signal Transduction,Cell Biology Developmental Biology,Cytoskeleton,Intermediate Filaments,Microtubules,Extracellular Matrix,Keratin.