Anti-CA12

Catalog Number: ATA-AMAB90639
Article Name: Anti-CA12
Biozol Catalog Number: ATA-AMAB90639
Supplier Catalog Number: AMAb90639
Alternative Catalog Number: ATA-AMAB90639-100,ATA-AMAB90639-25
Manufacturer: Atlas Antibodies
Host: Mouse
Category: Sonstiges
Application: IHC, WB
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: HsT18816
carbonic anhydrase XII
Anti-CA12
Clonality: Monoclonal
Concentration: 0.7
Clone Designation: [CL0280]
Isotype: IgG1
NCBI: 771
UniProt: O43570
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Protein A purified
Sequence: TASNKSEGLAVLAVLIEMGSFNPSYDKIFSHLQHVKYKGQEAFVPGFNIEELLPERTAEYYRYRGSLTTPPCNPTVLWTVFRNPVQISQEQLLALETALYCTHMDDPSPREMINNFRQVQ
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: CA12
Antibody Type: Monoclonal Antibody
Application Dilute: IHC: 1:200 - 1:500, WB: 1 µg/ml
Immunohistochemical staining of human kidney shows strong membranous and/or moderate cytoplasmic immunoreactivity in subsets of renal tubules, while glomeruli are negative.
Immunohistochemical staining of human colon shows strong cytoplasmic and membrane positivity in glandular cells.
Immunohistochemical staining of human pancreas shows strong membranous and moderate cytopalsmic positivity in the exocrine cells.
Immunohistochemical staining of human kidney (renal cancer) shows moderate immunoreactivity in cancer cells.
Lane 1: Marker [kDa]
Lane 2: Human RT-4 cell line
AMAb90639-100ul
AMAb90639-100ul
AMAb90639-100ul