SARS-CoV-2 (COVID-19) 3CL-Mpro Protein, Tag-free, E. coli

Catalog Number: TRZ-P2020-019_1000
Article Name: SARS-CoV-2 (COVID-19) 3CL-Mpro Protein, Tag-free, E. coli
Biozol Catalog Number: TRZ-P2020-019_1000
Supplier Catalog Number: P2020-019_1000
Alternative Catalog Number: TRZ-P2020-019_1000
Manufacturer: trenzyme
Host: E. coli
Category: Biochemikalien
Application: ELISA, WB
Species Reactivity: Virus
Alternative Names: 3CL Mpro, 3CL Pro, 3CL protease, 3C-like main protease, SARS-CoV-2, coronavirus, 2019-nCoV, COVID-2019, COVID-20, covid-19, sars-cov-2
The new coronavirus SARS-CoV-2 expresses two proteases, the papain-like protease (PLpro) and 3C-like protease (3CLpro). Both belong to the group of cysteine proteases, as they have a cysteine residue at their catalytic site. Their main function is the pr
Molecular Weight: 36,0 kDa
UniProt: P0DTD2
Buffer: PBS, contains Glycerol as protectant
Purity: > 90% as determined by SDS-PAGE
Form: liquid
Sequence: SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE PLTQDHVDIL
Formula: pH 7,4
SDS-Page of SARS-CoV-2 (COVID-19) 3CL-Mpro Protein Tag-free
Structural model of 3CL-Mpro Protein Tag-free
Histogram of SARS-CoV-2 (COVID-19) 3CL-Mpro Protein Tag-free
Inhibition of Protease 3CL-Mpro by GC376 (2% DMSO)