SARS-CoV-2 (COVID-19) Spike S1 Protein (RBD), Tag-free

Product Overview

• Article Name: SARS-CoV-2 (COVID-19) Spike S1 Protein (RBD), Tag-free
• Biozol Catalog Number: TRZ-P2020-022_1000
• Supplier Catalog Number: P2020-022_1000
• Alternative Catalog Number: TRZ-P2020-022_1000
• Manufacturer: trenzyme
• Category: Biochemikalien
• Application: ELISA, FA, WB
• Species Reactivity: Virus
• Alternative Names: SARS-CoV-2, coronavirus, SARS-CoV-2 spike RBD, SARS-CoV-2 spike protein, 2019-nCoV, COVID-2019, COVID-19, covid-19, sars-cov-2

Product Description

The spike (S) glycoprotein of coronaviruses is essential for binding of the virus to the host cell at the beginning of the infection process. The severe acute respiratory syndrome-coronavirus (SARS-CoV) spike (S) glycoprotein is responsible for membrane

Product Properties

• Molecular Weight: 25,2 kDa
• UniProt: P0DTC3
• Buffer: PBS
• Purity: > 90% as determined by SDS-PAGE
• Form: liquid
• Sequence: MRVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYA DSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAG STPCNGVEGFNCYFPLQSYGFQPTNGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNF
• Formula: pH 7,4

Images

Structural model of Spike S1 Protein (RBD) Tag-free

S1(RBD) with and without His-Tag are active

RBD (Tag-free) binds ACE2 detected by monoclonal antibody CR3022 (conformational antibody)

Histogram of Spike S1 Protein (RBD) Tag-free

SDS-Page of Spike S1 Protein (RBD) Tag-free