SARS-CoV-2 (COVID-19) Spike S1 Protein (RBD), Tag-free

Catalog Number: TRZ-P2020-022_1000
Article Name: SARS-CoV-2 (COVID-19) Spike S1 Protein (RBD), Tag-free
Biozol Catalog Number: TRZ-P2020-022_1000
Supplier Catalog Number: P2020-022_1000
Alternative Catalog Number: TRZ-P2020-022_1000
Manufacturer: trenzyme
Category: Biochemikalien
Application: ELISA, FA, WB
Species Reactivity: Virus
Alternative Names: SARS-CoV-2, coronavirus, SARS-CoV-2 spike RBD, SARS-CoV-2 spike protein, 2019-nCoV, COVID-2019, COVID-19, covid-19, sars-cov-2
The spike (S) glycoprotein of coronaviruses is essential for binding of the virus to the host cell at the beginning of the infection process. The severe acute respiratory syndrome-coronavirus (SARS-CoV) spike (S) glycoprotein is responsible for membrane
Molecular Weight: 25,2 kDa
UniProt: P0DTC3
Buffer: PBS
Purity: > 90% as determined by SDS-PAGE
Form: liquid
Sequence: MRVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYA DSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAG STPCNGVEGFNCYFPLQSYGFQPTNGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNF
Formula: pH 7,4
Structural model of Spike S1 Protein (RBD) Tag-free
S1(RBD) with and without His-Tag are active
RBD (Tag-free) binds ACE2 detected by monoclonal antibody CR3022 (conformational antibody)
Histogram of Spike S1 Protein (RBD) Tag-free
SDS-Page of Spike S1 Protein (RBD) Tag-free