mature TGF-beta 1, Human

Product Overview

• Article Name: mature TGF-beta 1, Human
• Biozol Catalog Number: TRZ-P2020-116_50
• Supplier Catalog Number: P2020-116_50
• Alternative Catalog Number: TRZ-P2020-116_50
• Manufacturer: trenzyme
• Host: Human
• Category: Biochemikalien
• Application: ELISA, FA, WB
• Species Reactivity: Human
• Alternative Names: Transforming growth factor beta 1, TGF-beta1, mature TGF-beta1

Product Description

Transforming growth factor-beta 1 (TGF- beta1) is a multifaceted and tightly regulated cytokine that plays a crucial role in regulating innate and adaptive immune responses. It is a member of the TGF-beta superfamily and belongs to the TGF-beta subfamily of cytok

Product Properties

• Molecular Weight: 12,8 kDa
• UniProt: P01137
• Buffer: PBS
• Purity: > 90% as determined by SDS-PAGE
• Form: lyophilized
• Sequence: VLALYNQHNPGASAAPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS
• Formula: pH 7,4

Images

SDS-Page of mature TGF-beta 1

Structural model of mature TGF-beta 1

Activity Assay of mature TGF-beta 1

Histogram of mature TGF-beta 1

Western Blot of mature TGF-beta 1